PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00135g00313.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 978aa    MW: 109667 Da    PI: 5.4566
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00135g00313.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.19.8e-14853248
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
           Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                              g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
  Peaxi162Scf00135g00313.1  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                              78*****************************.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.5E-17560IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
SuperFamilySSF466895.19E-15681IPR009057Homeodomain-like
PfamPF002491.2E-11853IPR001005SANT/Myb domain
CDDcd001673.84E-121053No hitNo description
CDDcd116594.14E-2255101No hitNo description
PROSITE profilePS512948.10458102IPR017930Myb domain
SMARTSM007170.1458100IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-56299IPR009057Homeodomain-like
PfamPF139215.2E-562105No hitNo description
PfamPF118311.2E-57401643IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 978 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKA  60
KDEKLLHLAK LMPTQWRTIA PIVGRTPSQC LERYEKLLDA ACAKDENYDP NDDPRKLRPG  120
EIDPNPESKP ARPDPVDMDE DEKEMLSEAR ARLANTRGKK AKRKAREKQL EEARRLASLQ  180
KRRELKAAGI DARQRKRKRR GIDYNAEIPF EKKPPPGFYD VAEEDRPVEQ PKFPTTIEEL  240
EGERRVDREA RLRKQDVARN KIAQRQDAPT AILHANKLND PEAVRRRSKL NLPAPQIPDH  300
ELEAIAKIGI ASDLLGGDEL SEGNAATRAL LANYAQTPQH AMTPMRTPQR TPATKQDAIM  360
MEAENQRRLN QSQTPLLGGD NPMLHPSDFS GVTPKKREVQ TPNPLLTPSA TPGSSGLTPR  420
IGMTPSRDSY GMTPKGTPMR DELHINEEMD MHNNAKLGQL SSKKELLSGL KSLPQPKNEY  480
QIVVQPAPEE NEEPEEKIEE DMSDRIAREK AEEEAKRQAL LRKRSKVLQR ELPRPPIGSL  540
ELIRSSLLRA DGEQSSFVPP TLIEQADEMI RKELLSLLEH DNSKYPLDEK AEKEKKKGVK  600
RKLAAEPLIE DFEEDELKEA DGLIKDESQF LCVAMGHESE SLDEFVEAHK TTLNDIMYFP  660
SRNAYGLSSV AGNMEKLAAL QKEFENVKKK MDDDTKKATK LEQKIKVLTN GYQMRAGKLW  720
SQIEGTFKQM DTAGTELECF QALQKQEQLA ASHRINNLWD EVQKQKELER TLQKRYGDLI  780
SEKEKIQHIM DEYRIQAQMQ EENAAKNRAL ELAKAEAEAV KNQQAPHPVA EAPNDQGDMS  840
VDPAPEGSLD GMAEKQSSPP AAVEASLTDV VQVKLTDEVQ VKLTDEVQVK PLATGSEAVD  900
SSVSSQCSNA EENSASASQS TVIEVSPTDE VHEKPVDTSS EAVNTIVSSQ CSNPEDNSAS  960
ASQSVASETP PTYDPIPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W3e-9632192236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1180199KRRELKAAGIDARQRKRKRR
2193199QRKRKRR
3194199RKRKRR
4595602KKGVKRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0954960.0EU095496.1 Solanum lycopersicum CDC5-like protein (cdc5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009631530.10.0PREDICTED: cell division cycle 5-like protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLM1ATK60.0M1ATK6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000299530.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61392431
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5